Structure of PDB 6qtm Chain A Binding Site BS01

Receptor Information
>6qtm Chain A (length=112) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSKSSWRQEWLANLKLISVSLVDEFPSELSDSDRQIINEKMQLLKDIFAN
NLKSAISNNFRESDIIILKGEIEDYPMSSEIKIYYNELQNKKARFWSFMK
TQRFVSNMGFDI
Ligand information
>6qtm Chain F (length=10) Species: 27291 (Saccharomyces paradoxus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SLDSSPPNTS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qtm The Sir4 H-BRCT domain interacts with phospho-proteins to sequester and repress yeast heterochromatin.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		W974 W978 R1066 K1072 N1079
Binding residue
(residue number reindexed from 1)		W6 W10 R94 K100 N107
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6qtm, PDBe:6qtm, PDBj:6qtm
PDBsum6qtm
PubMed31515872
UniProtP11978|SIR4_YEAST Regulatory protein SIR4 (Gene Name=SIR4)

[Back to BioLiP]