Structure of PDB 6qtc Chain A Binding Site BS01

Receptor Information
>6qtc Chain A (length=195) Species: 5478 (Nakaseomyces glabratus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRVINHPYYFPFNGKQAEDYLRSKERGDFVIRQSSRGDDHLAITWKLDKD
LFQHVDIQELEKENPLALGKVLVVEGQRYHDLDQIIVEYLQNKIRLLNEL
TSNEKFKAGTKKEVVKFIEDYSKVNPKKSVYYFSLNYENPGWFYLIFKLN
AESKLYIWNVKLTHTGFFLVNYNYPTVIQLCNGFKTLLKSSNTRN
Ligand information
>6qtc Chain B (length=16) Species: 5478 (Nakaseomyces glabratus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSYSPTSPSYSPTSPS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qtc tSH2 domain of transcription elongation factor Spt6 complexed with tyrosine phosphorylated CTD
ResolutionN/A
Binding residue
(original residue number in PDB)		R32 R36 Q53 H54 D56 Y131 E138 N139 W142 W158 N159 F184 K185 L188 K189 S191 N192
Binding residue
(residue number reindexed from 1)		R32 R36 Q53 H54 D56 Y131 E138 N139 W142 W158 N159 F184 K185 L188 K189 S191 N192
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0140673 transcription elongation-coupled chromatin remodeling

View graph for
Biological Process
External links
PDB RCSB:6qtc, PDBe:6qtc, PDBj:6qtc
PDBsum6qtc
PubMed
UniProtQ6FLB1|SPT6_CANGA Transcription elongation factor SPT6 (Gene Name=SPT6)

[Back to BioLiP]