Structure of PDB 6qg8 Chain A Binding Site BS01

Receptor Information
>6qg8 Chain A (length=137) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNREIVMKYISYKLSQRGYEWDESEVVHQTLRQAGDDFSLRYRRDFAEMS
SQLHLTPGTAYASFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SVLVDNIAAWMATYLNDHLHTWIQDNGGWDAFVELYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qg8 Establishing Drug Discovery and Identification of Hit Series for the Anti-apoptotic Proteins, Bcl-2 and Mcl-1.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		F104 Y108 F112 M115 L119 H120 S129 T132 V133 E136 L137 R139 R146
Binding residue
(residue number reindexed from 1)		F38 Y42 F46 M49 L53 H54 S63 T66 V67 E70 L71 R73 R80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6qg8, PDBe:6qg8, PDBj:6qg8
PDBsum6qg8
PubMed31459977
UniProtP10415|BCL2_HUMAN Apoptosis regulator Bcl-2 (Gene Name=BCL2);
Q07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]