Structure of PDB 6qfm Chain A Binding Site BS01

Receptor Information
>6qfm Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDDLYRQSLEIISRYLREQATGAATSRKALETLRRVGDGVQRNHETAFQG
MLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKS
VNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qfm Establishing Drug Discovery and Identification of Hit Series for the Anti-apoptotic Proteins, Bcl-2 and Mcl-1.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		H224 F228 M231 K234 L235 V249 H252 V253 D256 N260 G262 R263 T266 F318 F319 H320
Binding residue
(residue number reindexed from 1)		H44 F48 M51 K54 L55 V69 H72 V73 D76 N80 G82 R83 T86 F138 F139 H140
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6qfm, PDBe:6qfm, PDBj:6qfm
PDBsum6qfm
PubMed31459977
UniProtQ07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]