Structure of PDB 6qfi Chain A Binding Site BS01

Receptor Information
>6qfi Chain A (length=147) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DELYRQSLEIISRYLREQATGAKDTKSGATSRKALETLRRVGDGVQRNHE
TAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA
KHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVE
Ligand information
>6qfi Chain B (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RPEIWIAQELRRIGDEFNAYYAR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qfi Establishing Drug Discovery and Identification of Hit Series for the Anti-apoptotic Proteins, Bcl-2 and Mcl-1.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		V216 V220 H224 G230 M231 K234 L235 S245 R248 V249 H252 V253 D256 N260 G262 R263 T266 F318 F319
Binding residue
(residue number reindexed from 1)		V41 V45 H49 G55 M56 K59 L60 S70 R73 V74 H77 V78 D81 N85 G87 R88 T91 F143 F144
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6qfi, PDBe:6qfi, PDBj:6qfi
PDBsum6qfi
PubMed31459977
UniProtQ07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]