Structure of PDB 6qec Chain A Binding Site BS01

Receptor Information
>6qec Chain A (length=65) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRQGKTLKRPRLVWTPQLHKRFVDVVAHLGIKNAVPKTIMQLMNVEGLTR
ENVASHLQKYRLYLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qec Molecular mechanisms of Evening Complex activity inArabidopsis.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		P171 K172 R185 Q193 R196
Binding residue
(residue number reindexed from 1)		P36 K37 R50 Q58 R61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6qec, PDBe:6qec, PDBj:6qec
PDBsum6qec
PubMed32165537
UniProtQ9SNB4|PCL1_ARATH Transcription factor LUX (Gene Name=LUX)

[Back to BioLiP]