Structure of PDB 6q67 Chain A Binding Site BS01

Receptor Information
>6q67 Chain A (length=126) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVIAAPSMWTRPQIRDFKEKIRQDSDSVITVGRGEVVTVRVPTHEEGSYL
FWEFATDNYDIGFGVYFEWTKPVLDEIVPVYRRDCHEEVYAGSHQYPGRG
VYLLKFDNSYSLWRSKSVYYRVYYTR
Ligand information
>6q67 Chain B (length=28) Species: 1298633 (Kobuvirus cebes) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GLTIEAEPTELSYQDALEMLAESKPVST
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6q67 Structural basis for hijacking of the host ACBD3 protein by bovine and porcine enteroviruses and kobuviruses.
Resolution2.249 Å
Binding residue
(original residue number in PDB)		M374 W375 T376 R377 P378 Q379 T404 V405 R406 V407 P408 F417 E419 Y484 R486 V525 Y526 Y527
Binding residue
(residue number reindexed from 1)		M8 W9 T10 R11 P12 Q13 T38 V39 R40 V41 P42 F51 E53 Y81 R83 V122 Y123 Y124
Enzymatic activity
Enzyme Commision number ?
External links