Structure of PDB 6q36 Chain A Binding Site BS01

Receptor Information
>6q36 Chain A (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAV
DIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNGSSFYGVSSQ
YESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEY
MINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSA
SEHGAQHHIYRLVKE
Ligand information
>6q36 Chain C (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PWRLRKLPDSFIKEP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6q36 Structure-based design of potent linear peptide inhibitors of the YAP-TEAD protein-protein interaction derived from the YAP omega-loop sequence.
Resolution2.01 Å
Binding residue
(original residue number in PDB)		E263 A264 V265 D266 Q269 I270 D272 K273 K297 W299 V414 S418 A419 S420 Q425 H427 Y429 E434
Binding residue
(residue number reindexed from 1)		E48 A49 V50 D51 Q54 I55 D57 K58 K82 W84 V195 S199 A200 S201 Q206 H208 Y210 E215
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6q36, PDBe:6q36, PDBj:6q36
PDBsum6q36
PubMed31235263
UniProtQ15561|TEAD4_HUMAN Transcriptional enhancer factor TEF-3 (Gene Name=TEAD4)

[Back to BioLiP]