Structure of PDB 6py2 Chain A Binding Site BS01

Receptor Information
>6py2 Chain A (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVADHVASYGVNLYQSYGPSGQFTHEFDGDEEFYVDLERKETVWKLPLFH
RLRFDPQFALTNIAVLKHNLNILIKRSNSTAATNEVPEVTVFSKSPVTLG
QPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISY
LTFLPSADEIYDCKVEHWGLDEPLLKHWEPEI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6py2 A molecular basis for the T cell response in HLA-DQ2.2 mediated celiac disease.
Resolution2.82543 Å
Binding residue
(original residue number in PDB)		Y8 H24 R52 F53 F57 N61 V64 H67 N68 I71
Binding residue
(residue number reindexed from 1)		Y9 H25 R53 F54 F58 N62 V65 H68 N69 I72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6py2, PDBe:6py2, PDBj:6py2
PDBsum6py2
PubMed31974305
UniProtQ08AS3

[Back to BioLiP]