Structure of PDB 6pxc Chain A Binding Site BS01

Receptor Information
>6pxc Chain A (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TAPPTNQWYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQ
MNVVNHFRIIAMSGDYYIGGRRFSSLSDLIGYYSHVSSLLKGEKLLYPVA
PPEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pxc Crystal structures of p120RasGAP N-terminal SH2 domain in its apo form and in complex with a p190RhoGAP phosphotyrosine peptide.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		R188 R207 R211 V217 H229 F230 R231 I241 Y256 S260 L262
Binding residue
(residue number reindexed from 1)		R15 R34 R38 V44 H56 F57 R58 I68 Y83 S87 L89
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6pxc, PDBe:6pxc, PDBj:6pxc
PDBsum6pxc
PubMed31891593
UniProtP20936|RASA1_HUMAN Ras GTPase-activating protein 1 (Gene Name=RASA1)

[Back to BioLiP]