Structure of PDB 6psd Chain A Binding Site BS01

Receptor Information
>6psd Chain A (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDAL
DADGNGYLTPQEFTTGFSHFFFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6psd A tunable LIC1-adaptor interaction modulates dynein activity in a cargo-specific manner.
Resolution2.66 Å
Binding residue
(original residue number in PDB)		F58 L82 L84 V92 F113 F116
Binding residue
(residue number reindexed from 1)		F12 L36 L38 V46 F67 F70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:6psd, PDBe:6psd, PDBj:6psd
PDBsum6psd
PubMed33173051
UniProtQ9BSW2|EFC4B_HUMAN EF-hand calcium-binding domain-containing protein 4B (Gene Name=CRACR2A)

[Back to BioLiP]