Structure of PDB 6psa Chain A Binding Site BS01

Receptor Information
>6psa Chain A (length=45) Species: 11706,559292 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLRARIL
Ligand information
>6psa Chain H (length=16) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KGHPCDYPEWQWLCEL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6psa Characterization of resistance to a potent D-peptide HIV entry inhibitor.
Resolution1.3 Å
Binding residue
(original residue number in PDB)		R1 L32 W35 Q39
Binding residue
(residue number reindexed from 1)		R1 L32 W35 Q39
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6psa, PDBe:6psa, PDBj:6psa
PDBsum6psa
PubMed31640718
UniProtP03069|GCN4_YEAST General control transcription factor GCN4 (Gene Name=GCN4);
P04578|ENV_HV1H2 Envelope glycoprotein gp160 (Gene Name=env)

[Back to BioLiP]