Structure of PDB 6po1 Chain A Binding Site BS01

Receptor Information

>6po1 Chain A (length=341) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALPTPHEIRNHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDTSNGVELGK
SNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENII
QKLLQKSDYDVQKAQRGIVYIDQIDKISRKSDNRDVSGEGVQQALLKLIE
GTVAAVPPQGEFLQVDTSKILFICGGAFAGLDKVISHRVETGSGIGFGAT
VKAKSDKASEGELLAQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALI
QILKEPKNALTKQYQALFNLEGVDLEFRDEALDAIAKKAMARKTGARGLR
SIVEAALLDTMYDLPSMEDVEKVVIDESVIDGQSEPLLIYG

Ligand information

>6po1 Chain S (length=12) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAAAAAAAAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6po1 Structures of the ATP-fueled ClpXP proteolytic machine bound to protein substrate.
Resolution	4.2 Å
Binding residue (original residue number in PDB)	N195 R200
Binding residue (residue number reindexed from 1)	N133 R134

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0016887	ATP hydrolysis activity
GO:0051082	unfolded protein binding
GO:0140662	ATP-dependent protein folding chaperone

	Biological Process
GO:0006457	protein folding

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6po1, PDBe:6po1, PDBj:6po1
PDBsum	6po1
PubMed	32108573
UniProt	P0A6H1\|CLPX_ECOLI ATP-dependent Clp protease ATP-binding subunit ClpX (Gene Name=clpX)

[Back to BioLiP]