Structure of PDB 6pmd Chain A Binding Site BS01

Receptor Information
>6pmd Chain A (length=184) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LIPTVIAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDI
YLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKG
KRFALPNAEVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQ
SIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pmd Ureadepsipeptides as ClpP Activators.
Resolution2.21 Å
Binding residue
(original residue number in PDB)
D27 I29 Y61 Y63 Q89 M190
Binding residue
(residue number reindexed from 1)
D17 I19 Y51 Y53 Q79 M180
Enzymatic activity
Catalytic site (original residue number in PDB) G69 S98 M99 H123 D172
Catalytic site (residue number reindexed from 1) G59 S88 M89 H113 D162
Enzyme Commision number 3.4.21.92: endopeptidase Clp.
Gene Ontology
Molecular Function
GO:0004176 ATP-dependent peptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
GO:0051117 ATPase binding
Biological Process
GO:0006508 proteolysis
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins
Cellular Component
GO:0005737 cytoplasm
GO:0009368 endopeptidase Clp complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6pmd, PDBe:6pmd, PDBj:6pmd
PDBsum6pmd
PubMed31588734
UniProtQ2G036|CLPP_STAA8 ATP-dependent Clp protease proteolytic subunit (Gene Name=clpP)

[Back to BioLiP]