Structure of PDB 6pju Chain A Binding Site BS01

Receptor Information

>6pju Chain A (length=171) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHA
LMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQKF
SGPWFGGLSGVVFALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGMA
NGAHIAGLAVGLAMAFVDSLN

Ligand information

>6pju Chain B (length=4) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VRMA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6pju Ten catalytic snapshots of rhomboid intramembrane proteolysis from gate opening to peptide release.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	M120 H150 W196 F197 G198 G199 S201 M249 A250
Binding residue (residue number reindexed from 1)	M28 H58 W104 F105 G106 G107 S109 M149 A150

Enzymatic activity

Enzyme Commision number

3.4.21.105: rhomboid protease.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6pju, PDBe:6pju, PDBj:6pju
PDBsum	6pju
PubMed	31570873
UniProt	P09391\|GLPG_ECOLI Rhomboid protease GlpG (Gene Name=glpG)

[Back to BioLiP]