Structure of PDB 6pjr Chain A Binding Site BS01

Receptor Information

>6pjr Chain A (length=176) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHA
LMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQKF
SGPWFGGLSGVVFALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWF
MSMANGAHIAGLAVGLAMAFVDSLNA

Ligand information

>6pjr Chain B (length=5) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KVRMA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6pjr Ten catalytic snapshots of rhomboid intramembrane proteolysis from gate opening to peptide release.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	F146 H150 S193 W196 F197 G198 G199 S201 S248 M249 A250
Binding residue (residue number reindexed from 1)	F54 H58 S101 W104 F105 G106 G107 S109 S152 M153 A154

Enzymatic activity

Enzyme Commision number

3.4.21.105: rhomboid protease.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6pjr, PDBe:6pjr, PDBj:6pjr
PDBsum	6pjr
PubMed	31570873
UniProt	P09391\|GLPG_ECOLI Rhomboid protease GlpG (Gene Name=glpG)

[Back to BioLiP]