Structure of PDB 6pjq Chain A Binding Site BS01

Receptor Information
>6pjq Chain A (length=173) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTH
ALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQK
FSGPWFGGLSGVVFALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGS
MANGAHIAGLAVGLAMAFVDSLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pjq Ten catalytic snapshots of rhomboid intramembrane proteolysis from gate opening to peptide release.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		M120 H150 N154 W196 F197 G198 G199 S201 S248 M249 A250 H254
Binding residue
(residue number reindexed from 1)		M29 H59 N63 W105 F106 G107 G108 S110 S150 M151 A152 H156
Enzymatic activity
Enzyme Commision number 3.4.21.105: rhomboid protease.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6pjq, PDBe:6pjq, PDBj:6pjq
PDBsum6pjq
PubMed31570873
UniProtP09391|GLPG_ECOLI Rhomboid protease GlpG (Gene Name=glpG)

[Back to BioLiP]