Structure of PDB 6pjp Chain A Binding Site BS01

Receptor Information
>6pjp Chain A (length=174) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHA
LMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQKF
SGPWFGGLSGVVFALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWF
SMANGAHIAGLAVGLAMAFVDSLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pjp Ten catalytic snapshots of rhomboid intramembrane proteolysis from gate opening to peptide release.
Resolution2.45 Å
Binding residue
(original residue number in PDB)
M120 F146 H150 N154 S193 W196 F197 G198 S201 S248 M249 A250 H254
Binding residue
(residue number reindexed from 1)
M28 F54 H58 N62 S101 W104 F105 G106 S109 S151 M152 A153 H157
Enzymatic activity
Enzyme Commision number 3.4.21.105: rhomboid protease.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6pjp, PDBe:6pjp, PDBj:6pjp
PDBsum6pjp
PubMed31570873
UniProtP09391|GLPG_ECOLI Rhomboid protease GlpG (Gene Name=glpG)

[Back to BioLiP]