Structure of PDB 6pj4 Chain A Binding Site BS01

Receptor Information

>6pj4 Chain A (length=180) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ERAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFT
HALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQ
KFSGPWFGGLSGVVFALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG
WFDLMSMANGAHIAGLAVGLAMAFVDSLNA

Ligand information

>6pj4 Chain B (length=3) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VRM

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6pj4 Ten catalytic snapshots of rhomboid intramembrane proteolysis from gate opening to peptide release.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	M120 F146 H150 W196 F197 G198 S248 M249 A250
Binding residue (residue number reindexed from 1)	M30 F56 H60 W106 F107 G108 S156 M157 A158

Enzymatic activity

Enzyme Commision number

3.4.21.105: rhomboid protease.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6pj4, PDBe:6pj4, PDBj:6pj4
PDBsum	6pj4
PubMed	31570873
UniProt	P09391\|GLPG_ECOLI Rhomboid protease GlpG (Gene Name=glpG)

[Back to BioLiP]