Structure of PDB 6pcp Chain A Binding Site BS01

Receptor Information
>6pcp Chain A (length=140) Species: 520 (Bordetella pertussis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGPYHFSEQVGHLLRRAYQRHVAIFQQTIPDSKLTAAQFVVLCALRDQGA
CSLVDVVKATAIDQATVRGVIERLKARKLLAVSHDPADRRKVLVTLTPDG
RALVEEMVPFAEQITQSTFGGLNPAERVAIVYLLRKMSDA
Ligand information
Ligand IDOA7
InChIInChI=1S/C6H5NO3/c8-5-2-1-4(3-7-5)6(9)10/h1-3H,(H,7,8)(H,9,10)
InChIKeyBLHCMGRVFXRYRN-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 12.01c1cc(O)ncc1C(O)=O
OpenEye OEToolkits 2.0.7c1cc(ncc1C(=O)O)O
CACTVS 3.385OC(=O)c1ccc(O)nc1
FormulaC6 H5 N O3
Name6-hydroxypyridine-3-carboxylic acid;
6-hydroxynicotinic acid
ChEMBLCHEMBL95293
DrugBank
ZINCZINC000008576188
PDB chain6pcp Chain A Residue 201 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pcp Structural mechanism for regulation of DNA binding of BpsR, a Bordetella regulator of biofilm formation, by 6-hydroxynicotinic acid.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
H23 R26
Binding residue
(residue number reindexed from 1)
H12 R15
Annotation score1
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 09:30:02 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6pcp', asym_id = 'A', bs = 'BS01', title = 'Structural mechanism for regulation of DNA bindi...f biofilm formation, by 6-hydroxynicotinic acid. '
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6pcp', asym_id='A', bs='BS01', title='Structural mechanism for regulation of DNA bindi...f biofilm formation, by 6-hydroxynicotinic acid. ')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003700,0006355', uniprot = '', pdbid = '6pcp', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003700,0006355', uniprot='', pdbid='6pcp', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>