Structure of PDB 6p7q Chain A Binding Site BS01

Receptor Information
>6p7q Chain A (length=240) Species: 749537 (Escherichia coli MS 115-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASDWSLSQLFASLHEDIQLRLGTARKAFQHPGAKGDASEGVWIEMLDTYL
PKRYQAANAFVVDSLGNFSDQINVVVFDRQYSPFIFKFNEQIIVPAESVY
AVFEAKQSASADLVAYAQRKVASVRRLHRTSLPIPHAGGTYPAKPLIPIL
GGLLTFESDWSPALGMSFDKALNGDLSDGRLDMGCVASHGHFYFNNIDSK
FNFEHGNKPATAFLFRLIAQLQFSGTVPMIDIDAYGKWLA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6p7q Structure and Mechanism of a Cyclic Trinucleotide-Activated Bacterial Endonuclease Mediating Bacteriophage Immunity.
Resolution1.66 Å
Binding residue
(original residue number in PDB)		R53 Y81 I134 H136 T226 P228 M229
Binding residue
(residue number reindexed from 1)		R53 Y81 I134 H136 T226 P228 M229
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0004519 endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6p7q, PDBe:6p7q, PDBj:6p7q
PDBsum6p7q
PubMed31932164
UniProtD7Y2H5|NUCC_ECOM1 Endodeoxyribonuclease NucC (Gene Name=nucC)

[Back to BioLiP]