Structure of PDB 6p0g Chain A Binding Site BS01

Receptor Information
>6p0g Chain A (length=173) Species: 593117 (Thermococcus gammatolerans EJ3) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQLFIIGIGTGTDEYENFEETILKGVKRNELEGQIGPDILDNCCSDVCYF
WGRSKETIYEKKIDKGDMVLFYVGKRISRNKVDLNQETAVYLGIICETVE
ISENDVSFLNDFWRKGENFRFLMFFKKKPEKLHHSINEINSKLGYNPDYF
PIAGYVKPERMSGVYDILKNILK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6p0g The structure of theThermococcus gammatoleransMcrB N-terminal domain reveals a new mode of substrate recognition and specificity among McrB homologs.
Resolution2.27 Å
Binding residue
(original residue number in PDB)		N19 W53 G54 R55 R81 F121 I154
Binding residue
(residue number reindexed from 1)		N17 W51 G52 R53 R79 F119 I152
Binding affinityPDBbind-CN: Kd=0.707uM
Enzymatic activity
Enzyme Commision number ?
External links