Structure of PDB 6ozs Chain A Binding Site BS01

Receptor Information
>6ozs Chain A (length=244) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSF
VKVRACASLVVLSYPELKVVYEDSRMVGLKAPYVSGFLAFREVPFLVELV
QRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAKKLL
QVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKPLY
VSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSREYIRRTLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ozs Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
Resolution2.41 Å
Binding residue
(original residue number in PDB)
Y91 S93 G94 L96 E100 D126 N128 H132 Q133 V138 K155 K156 L158 Q159
Binding residue
(residue number reindexed from 1)
Y83 S85 G86 L88 E92 D118 N120 H124 Q125 V130 K147 K148 L150 Q151
Enzymatic activity
Enzyme Commision number 3.1.26.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6ozs, PDBe:6ozs, PDBj:6ozs
PDBsum6ozs
PubMed31444105
UniProtQ8C9A2|ENDOV_MOUSE Endonuclease V (Gene Name=Endov)

[Back to BioLiP]