Structure of PDB 6ozr Chain A Binding Site BS01

Receptor Information
>6ozr Chain A (length=243) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFV
KGDSVRACASLVVLSYPELKVVYEDSRMVGLKAPYVSGFLAFREVPFLVE
LVQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAKK
LLQVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKP
LYVSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSREYIRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ozr Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		V53 S54 F55 K57 Y91 S93 G94 L96 D126 N128 H132 G137 V138 A154 K155 K156 L158 Q159
Binding residue
(residue number reindexed from 1)		V47 S48 F49 K51 Y85 S87 G88 L90 D120 N122 H126 G131 V132 A148 K149 K150 L152 Q153
Enzymatic activity
Enzyme Commision number 3.1.26.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ozr, PDBe:6ozr, PDBj:6ozr
PDBsum6ozr
PubMed31444105
UniProtQ8C9A2|ENDOV_MOUSE Endonuclease V (Gene Name=Endov)

[Back to BioLiP]