Structure of PDB 6ozq Chain A Binding Site BS01

Receptor Information
>6ozq Chain A (length=243) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFV
SVRACASLVVLSYPELKVVYEDSRMVGLKAPYVSGFLAFREVPFLVELVQ
RLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAMKLLQ
VDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKPLYV
SVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSREYIRRTLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ozq Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
Resolution2.153 Å
Binding residue
(original residue number in PDB)		V53 S54 F55 Y91 S93 G94 L96 D126 N128 H132 G137 V138 M155 K156 L158 Q159 R244
Binding residue
(residue number reindexed from 1)		V47 S48 F49 Y82 S84 G85 L87 D117 N119 H123 G128 V129 M146 K147 L149 Q150 R235
Enzymatic activity
Enzyme Commision number 3.1.26.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ozq, PDBe:6ozq, PDBj:6ozq
PDBsum6ozq
PubMed31444105
UniProtQ8C9A2|ENDOV_MOUSE Endonuclease V (Gene Name=Endov)

[Back to BioLiP]