Structure of PDB 6ozn Chain A Binding Site BS01

Receptor Information
>6ozn Chain A (length=245) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFV
KGDSVRACASLVVLSYPELKVVYEDSRMVGLKAPYVSGFLAFREVPFLVE
LVQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAKK
LLQVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKP
LYVSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSREYIRRTL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ozn Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
D52 S54 F55 Y91 S93 G94 L96 D126 N128 H132 G137 V138 K155 K156 L158 Q159 R244
Binding residue
(residue number reindexed from 1)
D46 S48 F49 Y85 S87 G88 L90 D120 N122 H126 G131 V132 K149 K150 L152 Q153 R238
Enzymatic activity
Enzyme Commision number 3.1.26.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6ozn, PDBe:6ozn, PDBj:6ozn
PDBsum6ozn
PubMed31444105
UniProtQ8C9A2|ENDOV_MOUSE Endonuclease V (Gene Name=Endov)

[Back to BioLiP]