Structure of PDB 6ozi Chain A Binding Site BS01

Receptor Information

>6ozi Chain A (length=244) Species: 7719 (Ciona intestinalis)

DNKITDEQIAEWNSKQEELRDKIIRSDGDFSLSKVKYVGGFDVSYSKINH
ELAVSCMVVLSYPEMKQVYMNTTKVKLSCPYKSSYLAFREIEPFQQELQL
LKAKKPNLEPQVFLLDGNGFFHIRRCGAASHLGVLSNTRTIGVAKSLIEI
PEDGVKKTEVISQFKRLRKTGGNELDIISTEKNEVLAKAVLYAPKVEKPI
FVSAGHKCSLETAAKIVKGCTKTRIPEPIKMANKWSRKELKKIE

Ligand information

>6ozi Chain C (length=17)

ccgcgatatgcagcatt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6ozi Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
• Resolution: 2.302 Å
• Binding residue (original residue number in PDB): D43 V44 S45 Y46 Y82 S84 S85 L87 D117 G118 N119 G128 A129 A145 K146 S147 I149 E150 P152 K242
• Binding residue (residue number reindexed from 1): D42 V43 S44 Y45 Y81 S83 S84 L86 D116 G117 N118 G127 A128 A144 K145 S146 I148 E149 P151 K241

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 17:54:53 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6ozi', asym_id = 'A', bs = 'BS01', title = 'Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6ozi', asym_id='A', bs='BS01', title='Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004519,0006281', uniprot = '', pdbid = '6ozi', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519,0006281', uniprot='', pdbid='6ozi', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>