Structure of PDB 6ox2 Chain A Binding Site BS01

Receptor Information
>6ox2 Chain A (length=483) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKIRKKQKGLSV
TFDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEEL
FLWVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNIALAFHLLCERASPN
SFWQPYIQTLPSEYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAY
FYKVIQTHPHANKLPLKDSFTYEDYRWAVSSVMTRQNQIPTEDGSRVTLA
LIPLWDMCNHTNGLITTGYNLEDDRCECVALQDFRAGEQIYIFYGTRSNA
EFVIHSGFFFDNNSHDRVKIKLGVSKSDRLYAMKAEVLARAGIPTSSVFA
LHFTEPPISAQLLAFLRVFCMTEEELKEHLLGDSAIDRIFTLGNSEFPVS
WDNEVKLWTFLEDRASLLLKTYKTTIEEDKSVLKNHDLSVRAKMAIKLRL
GEKEILEKAVKSAAVNREYYRQQMEEKAPLPKY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ox2 Structural basis for the target specificity of actin histidine methyltransferase SETD3.
Resolution2.089 Å
Binding residue
(original residue number in PDB)		M151 N153 N211 R253 Q254 N255 P258 W273 D274 T285 G286 Y287 L289 Y312 R315 H323
Binding residue
(residue number reindexed from 1)		M133 N135 N193 R235 Q236 N237 P240 W255 D256 T267 G268 Y269 L271 Y294 R297 H305
Enzymatic activity
Enzyme Commision number 2.1.1.85: protein-histidine N-methyltransferase.
Gene Ontology
Molecular Function
GO:0003713 transcription coactivator activity
GO:0003779 actin binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008170 N-methyltransferase activity
GO:0008276 protein methyltransferase activity
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity
GO:0016279 protein-lysine N-methyltransferase activity
GO:0018064 protein-L-histidine N-tele-methyltransferase activity
GO:0042800 histone H3K4 methyltransferase activity
GO:0046975 histone H3K36 methyltransferase activity
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
Biological Process
GO:0006338 chromatin remodeling
GO:0018021 peptidyl-histidine methylation
GO:0018023 peptidyl-lysine trimethylation
GO:0030047 actin modification
GO:0032259 methylation
GO:0045893 positive regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051149 positive regulation of muscle cell differentiation
GO:0070472 regulation of uterine smooth muscle contraction
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ox2, PDBe:6ox2, PDBj:6ox2
PDBsum6ox2
PubMed31388018
UniProtQ86TU7|SETD3_HUMAN Actin-histidine N-methyltransferase (Gene Name=SETD3)

[Back to BioLiP]