Structure of PDB 6or1 Chain A Binding Site BS01

Receptor Information
>6or1 Chain A (length=235) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHLSTFGLMCKMADQ
TLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEG
SIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCL
KFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLL
RLPEIRAISMQAEEYLYYKHLNGDVNNLLIEMLHA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6or1 Development of the First Low Nanomolar Liver Receptor Homolog-1 Agonist through Structure-guided Design.
Resolution2.174 Å
Binding residue
(original residue number in PDB)		F354 R361 D372 M375 Q379 L531 E534 M535
Binding residue
(residue number reindexed from 1)		F53 R60 D71 M74 Q78 L228 E231 M232
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity

View graph for
Molecular Function
External links
PDB RCSB:6or1, PDBe:6or1, PDBj:6or1
PDBsum6or1
PubMed31419141
UniProtO00482|NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 (Gene Name=NR5A2)

[Back to BioLiP]