Structure of PDB 6oon Chain A Binding Site BS01

Receptor Information
>6oon Chain A (length=785) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LFQPPRRPGLGTVGKPIRLLANHFQVQIPKIDVYHYDVDIKPEKRPRRVN
REVVDTMVRHFKMQIFGDRQPGYDGKRNMYTAHPLPIGRDRVDMEVTLQT
FKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALDVITRHLPSMRYTPV
GRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWNMMLNIDVSATAFYRA
QPIIEFMCEVLDIQNIKPLTDSQRVKFTKEIRGLKVEVRKYRVCNVTRRP
ASHQTFPLMECTVAQYFKQKYSLQLKYPHLPCLQVTYLPLEVCNIVAGQR
CIKKLTDNQTSTMIKATARSAPDRQEEISRLVKSPDPYLKEFGIVVHNEM
TELTGRVLPAPMLQYGGRNKTVATPNQGVWDMRGKQFYAGIEIKVWAVAC
FAPQKQCREDLLKSFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMF
KHLKMTYVGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKT
SPQTLSNLCLKINAKLGGINNVLVPHQRPSVFQQPVIFLGADVTHPPKKP
SIAAVVGSMDGHPSRYCATVRVQTYSQEVIQDLTNMVRELLIQFYKSTRF
KPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDYRPGITYIVVQK
RHHTRLFCADKTERVGKSGNVPAGTTVDSTITHPSEFDFYLCSHAGIQGT
SRPSHYQVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYARLV
AFRARYHLVDKDRDPQALAKAVQIHHDTQHTMYFA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6oon Multidomain Convergence of Argonaute during RISC Assembly Correlates with the Formation of Internal Water Clusters.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R56 P57 V60 S210 A211 K256 Y269 F284 Y301 T327 Y328 T351 I355 T358 G516 K517 T518 Y521 K525 Q537 C538 V539 Q540 N543 T551 N554 L555 K558 K562 R712 R716 H755 I758 Q759 S762 R763 Y792 R794 C795 S800 Y806
Binding residue
(residue number reindexed from 1)		R45 P46 V49 S193 A194 K235 Y241 F256 Y266 T286 Y287 T310 I314 T317 G469 K470 T471 Y474 K478 Q490 C491 V492 Q493 N496 T504 N507 L508 K511 K515 R651 R655 H694 I697 Q698 S701 R702 Y731 R733 C734 S739 Y745
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0003727 single-stranded RNA binding
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0035198 miRNA binding
GO:0061980 regulatory RNA binding
Biological Process
GO:0006402 mRNA catabolic process
GO:0006417 regulation of translation
GO:0007130 synaptonemal complex assembly
GO:0007140 male meiotic nuclear division
GO:0008584 male gonad development
GO:0010501 RNA secondary structure unwinding
GO:0010586 miRNA metabolic process
GO:0022604 regulation of cell morphogenesis
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031054 pre-miRNA processing
GO:0035194 regulatory ncRNA-mediated post-transcriptional gene silencing
GO:0035196 miRNA processing
GO:0035278 miRNA-mediated gene silencing by inhibition of translation
GO:0035279 miRNA-mediated gene silencing by mRNA destabilization
GO:0043066 negative regulation of apoptotic process
GO:0070922 RISC complex assembly
GO:0090625 siRNA-mediated gene silencing by mRNA destabilization
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane
GO:0016442 RISC complex
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0043232 intracellular non-membrane-bounded organelle
GO:0070578 RISC-loading complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6oon, PDBe:6oon, PDBj:6oon
PDBsum6oon
PubMed31324450
UniProtQ9HCK5|AGO4_HUMAN Protein argonaute-4 (Gene Name=AGO4)

[Back to BioLiP]