Structure of PDB 6oi4 Chain A Binding Site BS01

Receptor Information
>6oi4 Chain A (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNV
EDDLIIFPDDCEFKRVPQCSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEH
CRKVNEYLNNP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6oi4 Phosphorylation of Tyr-950 in the proteasome scaffolding protein RPN2 modulates its interaction with the ubiquitin receptor RPN13.
Resolution1.76 Å
Binding residue
(original residue number in PDB)		T36 T37 V38 P40 R64 V85 Q87 C88 K97 R104 W108 Q110
Binding residue
(residue number reindexed from 1)		T17 T18 V19 P21 R45 V66 Q68 C69 K77 R84 W88 Q90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:6oi4, PDBe:6oi4, PDBj:6oi4
PDBsum6oi4
PubMed31064842
UniProtQ16186|ADRM1_HUMAN Proteasomal ubiquitin receptor ADRM1 (Gene Name=ADRM1)

[Back to BioLiP]