Structure of PDB 6ogk Chain A Binding Site BS01

Receptor Information
>6ogk Chain A (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELI
AYFEKVGDTSLDPNDFDFTVTGRGSP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ogk Plasticity at the DNA recognition site of the MeCP2 mCG-binding domain.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		R133 S134 V136 R162
Binding residue
(residue number reindexed from 1)		R44 S45 V47 R73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6ogk, PDBe:6ogk, PDBj:6ogk
PDBsum6ogk
PubMed31356990
UniProtP51608|MECP2_HUMAN Methyl-CpG-binding protein 2 (Gene Name=MECP2)

[Back to BioLiP]