Structure of PDB 6ocg Chain A Binding Site BS01

Receptor Information
>6ocg Chain A (length=247) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPS
VPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAK
EMTKEALPIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLG
VNFAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVK
LGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLKI
Ligand information
>6ocg Chain B (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SAQQELKQRQRAEIYALNRVMTELEQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ocg Structural basis of tubulin detyrosination by vasohibins.
Resolution1.833 Å
Binding residue
(original residue number in PDB)		P68 V69 W74 V81 H85 I95 R96 G97 I104 P105 I106 L132 Y134 H136 T137 F141 E163 A164 L165 P166
Binding residue
(residue number reindexed from 1)		P10 V11 W16 V23 H27 I37 R38 G39 I46 P47 I48 L74 Y76 H78 T79 F83 E105 A106 L107 P108
Enzymatic activity
Enzyme Commision number 3.4.17.17: tubulinyl-Tyr carboxypeptidase.
Gene Ontology
Biological Process
GO:0045765 regulation of angiogenesis
Cellular Component
GO:0005737 cytoplasm

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ocg, PDBe:6ocg, PDBj:6ocg
PDBsum6ocg
PubMed31235910
UniProtQ7L8A9|VASH1_HUMAN Tubulinyl-Tyr carboxypeptidase 1 (Gene Name=VASH1)

[Back to BioLiP]