Structure of PDB 6o5o Chain A Binding Site BS01

Receptor Information
>6o5o Chain A (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMA
AAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTD
NRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKK
K
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o5o Crystal Structure of the Disabled-2 (Dab2) Dab Homology Domain in Complex with Peptide STA02
Resolution1.75 Å
Binding residue
(original residue number in PDB)		R64 D66 V118 N119 K120 I121 S122 F123 I124 R126 G139 G140 E141 H144 V159 K163 F166 I169 Y170 K173
Binding residue
(residue number reindexed from 1)		R34 D36 V88 N89 K90 I91 S92 F93 I94 R96 G109 G110 E111 H114 V129 K133 F136 I139 Y140 K143
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6o5o, PDBe:6o5o, PDBj:6o5o
PDBsum6o5o
PubMed
UniProtP98082|DAB2_HUMAN Disabled homolog 2 (Gene Name=DAB2)

[Back to BioLiP]