Structure of PDB 6o3l Chain A Binding Site BS01

Receptor Information
>6o3l Chain A (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVQLVQSGAELKKPWSSVRVSCKASGGSFSSYAFNWVRQAPGQRLEWLGG
IVPLVSSTNYAQRFRGRVTISADRSTSTVYLEMTGLTSADTAVYFCAREG
EGWFGRPLRAFEFWGQGTLVTVSTASTKGPSVFPLAPSSGGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEPKS
Ligand information
>6o3l Chain E (length=16) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NWFDITNWLWYIKKKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o3l An MPER antibody neutralizes HIV-1 using germline features shared among donors.
Resolution1.98 Å
Binding residue
(original residue number in PDB)
S31 Y32 G50 I51 V52 S56 N58 E95 F100 G100A R100B P100C R100E
Binding residue
(residue number reindexed from 1)
S31 Y32 G50 I51 V52 S57 N59 E99 F104 G105 R106 P107 R109
External links