Structure of PDB 6o26 Chain A Binding Site BS01

Receptor Information
>6o26 Chain A (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVVQPGRSLRLSCAASGFTFSGSGMHWVRQAPGKGLEWVAI
IWYDGSNKFYADSVKGRFTISRDNSKNTLYLQMNSLRGEDTAVYYCARVG
DGDGNYMDVWGKGTTVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o26 Evolution of protective human antibodies against Plasmodium falciparum circumsporozoite protein repeat motifs.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		G31 S32 G33 W52 Y52A F58 V95 G96 N100A
Binding residue
(residue number reindexed from 1)		G31 S32 G33 W52 Y53 F59 V99 G100 N105
External links