Structure of PDB 6o25 Chain A Binding Site BS01

Receptor Information
>6o25 Chain A (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVVQPGRSLRLSCEASGFTFSSYGIHWVRQAPGKGLEWVAV
IWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARAG
YSNYGHYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKTSGGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKRVEP
Ligand information
>6o25 Chain D (length=11) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ANPNANPNANP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o25 Evolution of protective human antibodies against Plasmodium falciparum circumsporozoite protein repeat motifs.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
S31 Y32 G33 W52 Y52A Y58 S98 Y100 H100B
Binding residue
(residue number reindexed from 1)
S31 Y32 G33 W52 Y53 Y59 S102 Y104 H106
External links