Structure of PDB 6o23 Chain A Binding Site BS01

Receptor Information
>6o23 Chain A (length=225) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAV
IWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARAL
DDASSTSCCALDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALG
CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKRVEPK
Ligand information
>6o23 Chain E (length=18) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPNANPNANPNANPNANP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o23 Evolution of protective human antibodies against Plasmodium falciparum circumsporozoite protein repeat motifs.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		S31 Y32 G33 W52 Y52A Y58 D97 A99 S100C C100D C100E
Binding residue
(residue number reindexed from 1)		S31 Y32 G33 W52 Y53 Y59 D101 A103 S107 C108 C109
External links