Structure of PDB 6nsx Chain A Binding Site BS01

Receptor Information
>6nsx Chain A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDR
HPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nsx Cus2 enforces the first ATP-dependent step of splicing by binding to yeast SF3b1 through a UHM-ULM interaction.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		D290 E294 R335 W336 F337 G338 G339 I342
Binding residue
(residue number reindexed from 1)		D31 E35 R76 W77 F78 G79 G80 I83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6nsx, PDBe:6nsx, PDBj:6nsx
PDBsum6nsx
PubMed31110137
UniProtO43719|HTSF1_HUMAN 17S U2 SnRNP complex component HTATSF1 (Gene Name=HTATSF1)

[Back to BioLiP]