Structure of PDB 6nma Chain A Binding Site BS01

Receptor Information
>6nma Chain A (length=115) Species: 386891 (Moraxella bovoculi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYLVVQALIRACIIKEIDLYTEQLYNIIKSLPYDKRPNVVYSDQPLDPNN
LDLSEPELWAEQVGECMRYAHNDQPCFYIGSTKRELRVNYIVPVIGVRDE
IERVMTLEEVRNLHK
Ligand information
>6nma Chain G (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aauuucuacuaaguguagauggaaa
....<<<<<.....>>>>>......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nma Structural Basis for the Inhibition of CRISPR-Cas12a by Anti-CRISPR Proteins.
Resolution3.38 Å
Binding residue
(original residue number in PDB)		E184 M186 T201
Binding residue
(residue number reindexed from 1)		E65 M67 T82
External links