Structure of PDB 6ncm Chain A Binding Site BS01

Receptor Information

>6ncm Chain A (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

CKPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSV
RHNLSLNKCFKKVDKKGSLWCIDPEYRQNLIQALKKTPYHP

Ligand information

>6ncm Chain C (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atagcgtcttagcatg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6ncm Bispecific Forkhead Transcription Factor FoxN3 Recognizes Two Distinct Motifs with Different DNA Shapes.
Resolution	2.704 Å
Binding residue (original residue number in PDB)	V137 K138 R163 H164 S167 S187
Binding residue (residue number reindexed from 1)	V25 K26 R51 H52 S55 S68
Binding affinity	PDBbind-CN: Kd=238nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6ncm, PDBe:6ncm, PDBj:6ncm
PDBsum	6ncm
PubMed	30826165
UniProt	O00409\|FOXN3_HUMAN Forkhead box protein N3 (Gene Name=FOXN3)

[Back to BioLiP]