Structure of PDB 6n7i Chain A Binding Site BS01

Receptor Information
>6n7i Chain A (length=271) Species: 10760 (Escherichia phage T7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVVSALSLRERIREHLSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMG
KSTFVRQQALQWGTAMGKKVGLAMLQESVEETAEDLIGLHNRVRLRQSDS
LKREIIENGKFDQWFDELFGNDTFHLYDSTDRLLAKLAYMRSGLGCDVII
LDHISIVVDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEG
RPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTG
IAGYMEYNKETGWLEPSSYSG
Ligand information
>6n7i Chain F (length=17) Species: 10760 (Escherichia phage T7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVVSALSLRERIREHLS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n7i Structures and operating principles of the replisome.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		V346 E347 E348 A350 E351 I373 F378 D379 F382 F386 D389 L393 Y394 M412
Binding residue
(residue number reindexed from 1)		V79 E80 E81 A83 E84 I106 F111 D112 F115 F119 D122 L126 Y127 M140
Enzymatic activity
Enzyme Commision number 2.7.7.-
3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0003697 single-stranded DNA binding
GO:0003896 DNA primase activity
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0016779 nucleotidyltransferase activity
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0042802 identical protein binding
GO:0043139 5'-3' DNA helicase activity
GO:0046872 metal ion binding
Biological Process
GO:0006260 DNA replication
GO:0006269 DNA replication, synthesis of primer
GO:0032508 DNA duplex unwinding
GO:0039693 viral DNA genome replication
Cellular Component
GO:1990077 primosome complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n7i, PDBe:6n7i, PDBj:6n7i
PDBsum6n7i
PubMed30679383
UniProtP03692|HELIC_BPT7 DNA helicase/primase (Gene Name=4)

[Back to BioLiP]