Structure of PDB 6n6f Chain A Binding Site BS01

Receptor Information
>6n6f Chain A (length=180) Species: 666 (Vibrio cholerae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFSDQNLIWIDLEMTGLDPEMHKIIEMATIVTDSELNILAEGPVIAIHQP
ESELAKMDEWCTTTHTASGLVARVRQSQVSEEEAIDQTLAFLKQWVPEGK
SPICGNSIGQDRRFLYKHMPRLEAYFHYRYIDVSTIKELTRRWQPEVLKE
FSKTGSHLALDDIRESIAELQFYRKAVFKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n6f A dedicated diribonucleotidase resolves a key bottleneck for the terminal step of RNA degradation.
Resolution1.735 Å
Binding residue
(original residue number in PDB)		E14 M15 G17 L18 W61 C62 H66 N107 S108 Q111 S135 H158
Binding residue
(residue number reindexed from 1)		E13 M14 G16 L17 W60 C61 H65 N106 S107 Q110 S134 H157
Enzymatic activity
Enzyme Commision number 3.1.15.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003676 nucleic acid binding
GO:0004527 exonuclease activity
GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
Biological Process
GO:0006259 DNA metabolic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n6f, PDBe:6n6f, PDBj:6n6f
PDBsum6n6f
PubMed31225796
UniProtQ9KV17|ORN_VIBCH Oligoribonuclease (Gene Name=orn)

[Back to BioLiP]