Structure of PDB 6n4o Chain A Binding Site BS01

Receptor Information
>6n4o Chain A (length=796) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRVN
REIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPR
IFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTP
VGRSFFTASNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPV
IEFVCEVLDFKSIEEQTDSQRVKFTKEIKGLKVEITHCKRKYRVCNVTRR
PASHQTFPTVECTVAQYFKDRHKLVLRYPHLPCLQVGQQKHTYLPLEVCN
IVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSADFNTDPYVR
EFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTG
IEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYA
QGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQ
CVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLG
ADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAM
VRELLIQFYKSTRFKPTRIIFYRAGVSEGQFQQVLHHELLAIREACIKLE
KDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTE
FDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTR
SVSIPAPAYYAHLVAFRARYHLVDDHQALAKAVQVHQDTLRTMYFA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n4o Beyond the seed: structural basis for supplementary microRNA targeting by human Argonaute2.
Resolution2.899 Å
Binding residue
(original residue number in PDB)		K65 P67 T222 R277 R280 F294 Y311 H316 T337 Y338 R375 L522 G524 K525 T526 Y529 K533 Q545 C546 Q548 N551 Q558 T559 N562 L563 K566 A603 G604 R635 R714 H753 I756 Q757 T759 R761 Y790 R792 C793 R795 V797 S798 Y804
Binding residue
(residue number reindexed from 1)		K44 P46 T192 R240 R243 F257 Y267 H272 T292 Y293 R330 L477 G479 K480 T481 Y484 K488 Q500 C501 Q503 N506 Q513 T514 N517 L518 K521 A558 G559 R590 R669 H708 I711 Q712 T714 R716 Y745 R747 C748 R750 V752 S753 Y759
Enzymatic activity
Enzyme Commision number 3.1.26.n2: argonaute-2.
Gene Ontology
Molecular Function
GO:0000340 RNA 7-methylguanosine cap binding
GO:0000993 RNA polymerase II complex binding
GO:0001046 core promoter sequence-specific DNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0003727 single-stranded RNA binding
GO:0003729 mRNA binding
GO:0003743 translation initiation factor activity
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0016891 RNA endonuclease activity, producing 5'-phosphomonoesters
GO:0035197 siRNA binding
GO:0035198 miRNA binding
GO:0035925 mRNA 3'-UTR AU-rich region binding
GO:0046872 metal ion binding
GO:0061980 regulatory RNA binding
GO:0070551 endoribonuclease activity, cleaving siRNA-paired mRNA
GO:0090624 endoribonuclease activity, cleaving miRNA-paired mRNA
GO:0098808 mRNA cap binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006412 translation
GO:0006413 translational initiation
GO:0006417 regulation of translation
GO:0009791 post-embryonic development
GO:0010501 RNA secondary structure unwinding
GO:0010586 miRNA metabolic process
GO:0010628 positive regulation of gene expression
GO:0030422 siRNA processing
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031054 pre-miRNA processing
GO:0033962 P-body assembly
GO:0035194 regulatory ncRNA-mediated post-transcriptional gene silencing
GO:0035196 miRNA processing
GO:0035278 miRNA-mediated gene silencing by inhibition of translation
GO:0035279 miRNA-mediated gene silencing by mRNA destabilization
GO:0042985 negative regulation of amyloid precursor protein biosynthetic process
GO:0045727 positive regulation of translation
GO:0045766 positive regulation of angiogenesis
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0045947 negative regulation of translational initiation
GO:0060213 positive regulation of nuclear-transcribed mRNA poly(A) tail shortening
GO:0070922 RISC complex assembly
GO:0090128 regulation of synapse maturation
GO:0090625 siRNA-mediated gene silencing by mRNA destabilization
GO:1900153 positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:1901165 positive regulation of trophoblast cell migration
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane
GO:0016442 RISC complex
GO:0030425 dendrite
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0043232 intracellular non-membrane-bounded organelle
GO:0070062 extracellular exosome
GO:0070578 RISC-loading complex
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n4o, PDBe:6n4o, PDBj:6n4o
PDBsum6n4o
PubMed31268608
UniProtQ9UKV8|AGO2_HUMAN Protein argonaute-2 (Gene Name=AGO2)

[Back to BioLiP]