Structure of PDB 6mtv Chain A Binding Site BS01

Receptor Information
>6mtv Chain A (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LIEPARIEEEELTLTILRGGLGISIAGGKGSTPYKGDDEGIFISRVSEEG
PAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mtv Structural analysis of phosphorylation-associated interactions of human MCC with Scribble PDZ domains.
Resolution2.597 Å
Binding residue
(original residue number in PDB)		G737 L738 G739 I740 S741 I742 A743 S748 T749 S761 H793 L800
Binding residue
(residue number reindexed from 1)		G20 L21 G22 I23 S24 I25 A26 S31 T32 S44 H76 L83
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6mtv, PDBe:6mtv, PDBj:6mtv
PDBsum6mtv
PubMed31317644
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]