Structure of PDB 6mse Chain A Binding Site BS01

Receptor Information
>6mse Chain A (length=393) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAAD
KQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTD
IEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQ
IEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRT
DACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGA
RFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMR
PGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGA
EIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKFSAT
Ligand information
>6mse Chain v (length=28) Species: 285006 (Saccharomyces cerevisiae RM11-1a) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAAKAAG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mse Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		K248 Y249
Binding residue
(residue number reindexed from 1)		K215 Y216
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
GO:0036402 proteasome-activating activity
Biological Process
GO:0001649 osteoblast differentiation
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:1901800 positive regulation of proteasomal protein catabolic process
Cellular Component
GO:0000502 proteasome complex
GO:0000932 P-body
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0008540 proteasome regulatory particle, base subcomplex
GO:0016020 membrane
GO:0022624 proteasome accessory complex
GO:0034774 secretory granule lumen
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6mse, PDBe:6mse, PDBj:6mse
PDBsum6mse
PubMed30479383
UniProtP35998|PRS7_HUMAN 26S proteasome regulatory subunit 7 (Gene Name=PSMC2)

[Back to BioLiP]