Structure of PDB 6ms1 Chain A Binding Site BS01

Receptor Information
>6ms1 Chain A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAAR
AGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ms1 Crystal structure of the human Scribble PDZ1 domain bound to the PDZ-binding motif of APC.
Resolution1.35 Å
Binding residue
(original residue number in PDB)
E724 E725 E726 W812
Binding residue
(residue number reindexed from 1)
E3 E4 E5 W91
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ms1, PDBe:6ms1, PDBj:6ms1
PDBsum6ms1
PubMed30659601
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]