Structure of PDB 6mqe Chain A Binding Site BS01

Receptor Information
>6mqe Chain A (length=224) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQVSGPGVVRPSETLSLTCEVSSGSTSRDFFYWSWVRQTPGKGLEWI
GGMYSNSEETNHNPSLKSRVIISKDTSKNEFSLRLTSVTAADTAVYFCSS
RAKIYYSASYSGGRIDVWGPGLLVTVSSASTKGPSVFPLAPSSESTAALG
CLVKDYFPEPVTVSWNSGSLTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYVCNVNHKPSNTKVDKRVEI
Ligand information
>6mqe Chain D (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mqe Antibody Lineages with Vaccine-Induced Antigen-Binding Hotspots Develop Broad HIV Neutralization.
Resolution2.459 Å
Binding residue
(original residue number in PDB)		R31 D31A F31B F32 Y33 Y52 R95 A96 K97 Y99 Y100 R100H
Binding residue
(residue number reindexed from 1)		R31 D32 F33 F34 Y35 Y54 R101 A102 K103 Y105 Y106 R114
External links