Structure of PDB 6mqc Chain A Binding Site BS01

Receptor Information
>6mqc Chain A (length=222) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGPGVVKPSETLSLTCVVSGGTPGRGFLYWSWVRQPPGKGLEWI
GGTATNTDITDYNPSLKSRAAISKDTSRNQFLLNLKPLTAGDTAVYYCTS
RAKDYRGPSYSRIDVWGPGVLVTVSSASTKGPSVFPLAPSSESTAALGCL
VKDYFPEPVTVSWNSGSLTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYVCNVNHKPSNTKVDKRVEI
Ligand information
>6mqc Chain D (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mqc Antibody Lineages with Vaccine-Induced Antigen-Binding Hotspots Develop Broad HIV Neutralization.
Resolution1.99 Å
Binding residue
(original residue number in PDB)		R31 G31A F31B Y33 A96 K97 D98 Y99 R100 R100F
Binding residue
(residue number reindexed from 1)		R31 G32 F33 Y35 A102 K103 D104 Y105 R106 R112
External links