Structure of PDB 6ml4 Chain A Binding Site BS01

Receptor Information
>6ml4 Chain A (length=143) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSKSFTCDQCGKYFSQKRQLKSHYRVHTGHSLPECSHCHRKFMDVSQLKK
HLRTHTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCSICGKCFSD
SSAKRRHCILHTGKKPFSCPECGLQFARLDNLKAHLKIHSKEK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ml4 Structural basis of specific DNA binding by the transcription factor ZBTB24.
Resolution1.482 Å
Binding residue
(original residue number in PDB)
Q419 H423 T426 K431 F442 T443 S447 H451 I454 D472 R478 H479 L482 F498 R500 N503 H507
Binding residue
(residue number reindexed from 1)
Q47 H51 T54 K59 F70 T71 S75 H79 I82 D100 R106 H107 L110 F126 R128 N131 H135
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ml4, PDBe:6ml4, PDBj:6ml4
PDBsum6ml4
PubMed31226215
UniProtQ80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 (Gene Name=Zbtb24)

[Back to BioLiP]